PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma138g00110.1
Common NameZOSMA_138G00110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 126aa    MW: 15048.2 Da    PI: 8.5046
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma138g00110.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-20555656
                      S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      ++t+ q+eeLe++F k+ +ps +er+eL++kl+L+  qVk+WFqNrR ++k
  Zosma138g00110.1  5 RHTPRQVEELEAFFVKCDHPSVKERQELSEKLDLEMHQVKFWFQNRRNQMK 55
                      579********************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.694157IPR001356Homeobox domain
SMARTSM003899.7E-15161IPR001356Homeobox domain
SuperFamilySSF466891.59E-17465IPR009057Homeodomain-like
CDDcd000864.55E-14457No hitNo description
Gene3DG3DSA:1.10.10.606.4E-19562IPR009057Homeodomain-like
PfamPF000461.3E-17555IPR001356Homeobox domain
PROSITE patternPS0002703255IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MTTYRHTPRQ VEELEAFFVK CDHPSVKERQ ELSEKLDLEM HQVKFWFQNR RNQMKVQLGR  60
QNNCFLREEN VRLRAENELL WETMKKPLCK DCGNPSMEGQ RLRAENIRLK EEINRFCSSI  120
NGTGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877999.16e-42PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ6EPF08e-42ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0K9PYG14e-89A0A0K9PYG1_Z
STRINGBRADI3G51540.14e-40(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149301619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.23e-39HD-ZIP family protein